PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS519746.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family B3
Protein Properties Length: 112aa    MW: 13452.4 Da    PI: 9.7919
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS519746.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.76.1e-20594194
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
            B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                  ff v +++++ ++  l++p +f+++h +k++   +l+    s rsW+vkl+  +++++ +l++GW++Fv++ gL + D++vF+l++r++  ++v
  EcS519746.10  5 FFRVVMRPSYIQKY-LCVPCEFFRKHVQKNK---QLVTLRYSDRSWQVKLRSYGHRRMAFLSTGWSSFVRETGLHVSDVCVFELIDRNDIMFRV 94
                  66677777777775.9**********54433...355555699********9*********************************987774554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.49E-22197IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-252100IPR015300DNA-binding pseudobarrel domain
CDDcd100179.67E-16498No hitNo description
PROSITE profilePS5086311.9844100IPR003340B3 DNA binding domain
PfamPF023622.5E-17594IPR003340B3 DNA binding domain
SMARTSM010192.2E-14698IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
SDHPFFRVVM RPSYIQKYLC VPCEFFRKHV QKNKQLVTLR YSDRSWQVKL RSYGHRRMAF  60
LSTGWSSFVR ETGLHVSDVC VFELIDRNDI MFRVSNFNND GKDLIYIDRD GH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065668.11e-66PREDICTED: B3 domain-containing protein REM13-like isoform X2
TrEMBLA0A059BBI72e-65A0A059BBI7_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14804415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-14B3 family protein